PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.008G020300.1.p
Common NameSb08g001800, SORBIDRAFT_08g001800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 320aa    MW: 34915.6 Da    PI: 6.8909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.008G020300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-161461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd  lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Sobic.008G020300.1.p 14 KGPWTPEEDIVLVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding47.54.2e-1567112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T+ E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Sobic.008G020300.1.p  67 RGNFTPHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-22564IPR009057Homeodomain-like
PROSITE profilePS5129424.646965IPR017930Myb domain
SuperFamilySSF466894.08E-3011108IPR009057Homeodomain-like
SMARTSM007173.4E-121363IPR001005SANT/Myb domain
PfamPF002496.5E-151461IPR001005SANT/Myb domain
CDDcd001674.82E-111661No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.7466116IPR017930Myb domain
SMARTSM007175.4E-1366114IPR001005SANT/Myb domain
PfamPF002495.7E-1367112IPR001005SANT/Myb domain
CDDcd001677.66E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIVLVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF TPHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLQKQQ  120
AIGAIFAPPP PPSESPIIPA VVPTATTGSH ADCHHDDMMT LSKDSYGRPA SSTPAPADEV  180
TQFIGLCSPP FAATNGDTFS SPYASSMDNI SKLLNGFMMK SSPTQDDAAT NIKPSSVIDI  240
NPFDHKSGGA LSDDVPLLMP PPQQQQQQAL AGHGGYHKPK LQQLSSIEKW LFDEAAEQVV  300
DHQLMEISDG CCSVPSLLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-26141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-26141164105C-Myb DNA-Binding Domain
1msf_C6e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283081e-180KJ728308.1 Zea mays clone pUT6588 MYB transcription factor (MYB69) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441752.10.0hypothetical protein SORBIDRAFT_08g001800
TrEMBLC5YQR80.0C5YQR8_SORBI; Putative uncharacterized protein Sb08g001800
STRINGSb08g001800.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-83myb domain protein 60